SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F0REV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0REV8
Domain Number 1 Region: 266-442
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 5.89e-39
Family Endonuclease I 0.00052
Further Details:      
 
Weak hits

Sequence:  F0REV8
Domain Number - Region: 66-135
Classification Level Classification E-value
Superfamily Cadherin-like 0.0585
Family Cadherin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F0REV8
Sequence length 459
Comment (tr|F0REV8|F0REV8_CELLC) Endonuclease I {ECO:0000313|EMBL:ADY28913.1} KW=Complete proteome; Reference proteome OX=867900 OS=14961 / NCIMB 1423 / VKM B-1433 / Cy l20). GN=Celly_1084 OC=Flavobacteriaceae; Cellulophaga.
Sequence
MMTKSILNIKKYTYTILLSAITLGCSSSDGGTEQPDPEPTPVNKPIAVDDEVTGIENEEL
IISSLLENDSRIGATITSFDATSTGGATIIENRDGTYTYTPKADFIGVDTFTYTICDTEE
TPNCSTATVTVSIVDEGDPVAIDDAYATVENTATTITTALDNDTIIDDAILTSVDGSGSS
GTVELNSNGEIVYTPQSNFTSNDSFTYTICDNDKPDATCSTATITITIAEKLSFNIPAEL
QEYYSNVAFSNNAEVTLNALKEHTTNKHTTILSYGQRHNYLYNADEDETIADNVILMYSG
ESRDHREYQSGSNSHSPQTFNTEHIFPQSKLGSNIAVSDLHHLRSCDAIVNEDRSNFAYT
NGSGEYKLIDSNKWYPGDDWRGDVARMVLYLNIRYNEDITQVGTMDLFLEWNAADPVSSF
EIQRNNVIEEAQGNRNPFIDNPYLATIVWGGNEAENKWE
Download sequence
Identical sequences F0REV8
WP_013620661.1.53776 gi|325285994|ref|YP_004261784.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]