SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F0U4S6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0U4S6
Domain Number 1 Region: 258-342,369-409,448-475,555-622
Classification Level Classification E-value
Superfamily Kelch motif 2.88e-27
Family Kelch motif 0.015
Further Details:      
 
Domain Number 2 Region: 718-752,831-896
Classification Level Classification E-value
Superfamily POZ domain 0.0000573
Family BTB/POZ domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F0U4S6
Sequence length 1148
Comment (tr|F0U4S6|F0U4S6_AJEC8) Uncharacterized protein {ECO:0000313|EMBL:EGC41180.1} KW=Complete proteome; Reference proteome OX=544711 OS=(Histoplasma capsulatum). GN=HCEG_00542 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Histoplasma.
Sequence
MAGTGSERETGKPVEGSSPTKAVAEPPTPAIPPPPLTPDTSKRFTSVIKYFRSSKTRSTT
ISTTWPSRRFISKNSAKPPSEESSHNKISEALRLATPTTSKSPDLDLFRSPSLPVPAAVL
EPGLRQNIELERRFLEYQEPRETAHRKSSLPFLEPVVADSVPKSPLRTEAPFVKAFFESP
LVPSSNNKKADTSSQPTESVLKAMTSNNPIGGQYDSFQEQNAGPSTTTGNLTAQSPLPNG
QNSSSTPTNLSGLVCNVHRTTGREPRPLVGPSSTVLGDKLYVFGGRVQSRSRPELLTNEM
YELDLVRRHWTKLETTGDIPPPRYFHTVCALGDSKLVCYGGMSAKAALPNQPPATPNQTS
QRSGEEAQQGVVLLSDVHIFDVPSRTWIFIPTANAPRGRYAHCATILPSGATFGSSNAPI
SALHHNPSSSNPHQGTLGVEIDGYGGAEMIVVGGQDTSNHYFEEINVFNLRSLKWTSTTS
LDRSCGAYRSVATPLLGVKPSDIGGGVEVEGFRDPTKPDAQKPDPLLLIYSNYNFLDVKL
NLQLRTSDGKLTEKSMNGTVSPPGLRFPNGGIINGHFVVSGTYLTSSKQEYAMWALDLKT
LTWGRIDAGGAIFSHGSWNRGVLWSRRSTFVVIGHRKRSLVEDYNHRRINFSHICFVELE
AFGLYENPRRSAPTSGYVSVSSPMVPASLQAKISQQGAGGRPLSTTAEELGRMALSLREL
SDMELLTIGGERIPVNSHILARRWGPYFIQLLRESTIAEENMSDAATVRQQTSSHPSRNS
SITITPSVGNNSSYSAATTLIGHTGSSSNQKTPPSLLPNLEIPSAHTLTPTSRPRTLYLP
HTHLTVQLLVHYLYTSSLPPPGSQLCTPQILCSLLQLARPYQVDGLLEATVERLHQVLDG
RNAAAVFNAAAMAAGGGRGTGFASGPGGTLEVLNGVHSRSNAVASAIEPMSILNLNSNSD
TESGDTSGPRSGTVGGGPGQSQRRTPSAQRPANLRINTTNLNTGNAPGGFSAGGNRNRAE
SVSSAASTATSASTNTSLSFSESMGVDDIARHNDPNNKNKDDDMVGHERGRSKPEREIWT
GEISSVVGLQKRGLRGLMEGRRMRERGGRPANLPGAAGVGGEDGNSTDTGGAPPAISAAP
AGVAVGSG
Download sequence
Identical sequences F0U4S6
HCEG_00542T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]