SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F0UDS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0UDS7
Domain Number 1 Region: 5-279
Classification Level Classification E-value
Superfamily Mitochondrial carrier 5.1e-68
Family Mitochondrial carrier 0.00057
Further Details:      
 
Domain Number 2 Region: 472-513
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000837
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F0UDS7
Sequence length 569
Comment (tr|F0UDS7|F0UDS7_AJEC8) Mitochondrial carrier protein {ECO:0000313|EMBL:EGC44500.1} KW=Complete proteome; Reference proteome OX=544711 OS=(Histoplasma capsulatum). GN=HCEG_03715 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Histoplasma.
Sequence
MSTTAGAFIAGGLAACGAVTVTHSFETVKIRLQLQGELQSKREAVRKYRGVFHGVKVILQ
NEGARGLFRGIGSAYIYQVLLNGCRLGFYEPLRVNITQAIYKDSTHQSLGINVFSGAASG
VLGAAAGSPFFLVKTRLQSFSPFLPVGTQHKYRNSFDGLRQIYMGEGVKGLYRGVYAAMV
RTGFGSSVQLPTYFFAKRRLIKHLGMEDGPALHLASSTCSGFVVCCVMHPPDTIMSRMYN
QTGNLYKGVFDCLYKTISTEGVLAIYKGYFAHLARILPHTYNSLDGDSSDFISDLEHRLG
NSEIFPFRRNIPLFEKKADTMLRSGSSTARTVASKSQFPYGKFLKSENSEFLGFFSSRHQ
QFAVPCYTNISINPDSRSNVLGNYCKIKKNLRWLPKERVYAVCSGGPYLRGTVYGHLRKE
NGGESAIVLSYAVEESVEVLERHRPDQSYWYNDESQMFHGWTSGFLFRNPAQETERKLGI
KLPADYEEFLSIMNGFEQSWGGIVLDSPLHPTTRIIYQSRTRASEVRARQIAKGWESNRD
RQPLADSSLEDPGRPISAGVMEMGNMTMS
Download sequence
Identical sequences F0UDS7
HCEG_03715T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]