SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F0VEZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0VEZ6
Domain Number 1 Region: 3-85
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.79e-21
Family Chaperone J-domain 0.00092
Further Details:      
 
Domain Number 2 Region: 134-244
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.15e-19
Family PDI-like 0.0084
Further Details:      
 
Domain Number 3 Region: 397-505
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000561
Family Thioltransferase 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F0VEZ6
Sequence length 521
Comment (tr|F0VEZ6|F0VEZ6_NEOCL) Uncharacterized protein {ECO:0000313|EMBL:CBZ52290.1} KW=Complete proteome; Reference proteome OX=572307 OS=Neospora caninum (strain Liverpool). GN=NCLIV_020770 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Neospora.
Sequence
MPKPAYRKLAKQYHPDVNPGNEEKFLDIAKAHEVLSNEEQRKKYDMFGEAGLGEGGGPSP
DGSGGVPVDFADLFGGMFGGGAGGPNIKITFGGGDGPTFSGAPEGFGNFFSGGGHSGGFQ
EAPSNNASLYDAEDDEVTELGPQAVHRLIDGRDFVFFLALYNPRCRPCRQLKDEFVKAAK
RMKGIVPFGAVNCSRFGNLSYCQEAQHYPTLLFFPADKHSKRIDYRGERTAAAMVRFLSE
NLPSTVVVLTDESAETWFSTDPQIPKVVLFTDKRGTPPLFKYLSYQMRSQVAMGVVFKNQ
KNLLKAFGEGLEYQRTHQPPKPGAKPLPAEIIFPSLLAIDDIDRLTGEWIDVKNHVNQEL
LTLTLSRLAAKARTASGVSFRELTARRMASGECGKDDSQFCFVLLVPDAMGARQAPKDIF
AKLTELSEKLKRDPLKICWVNKDTQPGFTRVFSLPVDQEVVFLAYRPKRKKYEVMTSAPT
PSSVESFVNDVVSGGKQLTKKLTQFPQLARKQAKVPGHDEL
Download sequence
Identical sequences F0VEZ6
XP_003882322.1.31604 psu|NCLIV_020770 psu|NCLIV_020770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]