SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F0WF26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0WF26
Domain Number 1 Region: 336-467
Classification Level Classification E-value
Superfamily Chaperone J-domain 9.67e-25
Family Chaperone J-domain 0.00015
Further Details:      
 
Domain Number 2 Region: 14-114
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000765
Family DIX domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F0WF26
Sequence length 473
Comment (tr|F0WF26|F0WF26_9STRA) Uncharacterized protein AlNc14C79G5220 {ECO:0000313|EMBL:CCA19808.1} OX=890382 OS=Albugo laibachii Nc14. GN=ALNC14_059510 OC=Albugo.
Sequence
MTTSSPATNALWAFYYIQGEDGEDRSHPNAFKVPYSSSSDITLADIHRYFPLKNSSEFHF
RFRLNTHIRGAPGSDHNGKNPPSSKHTFFWLDITSVKQKVPLSNGRVICKLLRLDRPQRI
GLIFQRKPISIQTSIQKEAKETPGSRANSLEKAVRLSEYAEAERRGAYDQPGAPYEEVHA
PSKRDENSSQEPSTNKVPVEKTARKNPTSNESFEDFLSGGGPGKSSTGAGNHENNVNLMN
DHAWSQEGSASNMPRSPTSPKFRSAMDPLAQTKTTQNMNPAAAKTQAPPAFDDDGGQTVG
PVTLAEMRKFATSTSDGSNVYNSSLIDKSTKSEFVRRAMEERERKMHEEITKARQALQQR
EEAQRLLSIQKEQAYITIGPKLKAWAEDNGRTKNIRTLLSTMHQVMWENSKWQEVNMGKL
IQPLDVKKVYRKAMIVVHPDKSRGCNAEELLIAERVFAAVNTAWEEFIATNPC
Download sequence
Identical sequences F0WF26
CCA19808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]