SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F0ZGK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0ZGK2
Domain Number 1 Region: 6-249
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.35e-89
Family Inorganic pyrophosphatase 0.000000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F0ZGK2
Sequence length 259
Comment (tr|F0ZGK2|F0ZGK2_DICPU) Uncharacterized protein {ECO:0000313|EMBL:EGC36901.1} KW=Complete proteome; Reference proteome OX=5786 OS=Dictyostelium purpureum (Slime mold). GN=DICPUDRAFT_94197 OC=Dictyosteliaceae; Dictyostelium.
Sequence
MSGVVSKQVGETGSAQYRVFFLKDGKPVSPFHDVPLWVNKSQSVVNMLVEIPRGTNAKLE
IATKEYMNPIKQDTKDGKLRFVHDKYPFNYGALPQTWENPSVLDARTNAKGDNDPLDACE
IGSAQAAIGEFKQVKVLGVFAMIDAGETDWKILCIDVNDPAASLINSEEDLEKVLPGKVN
EVYTFLRDYKIPDGKGPNQFAFDGKLQNREFAVSVIEETEHEWKSLVAGKTESPLSIENV
SLNNSKTVTADEANAKLGF
Download sequence
Identical sequences F0ZGK2
XP_003286544.1.95606 jgi|Dicpu1|94197|estExt_fgeneshDP_pm.C_730005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]