SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1C742 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1C742
Domain Number 1 Region: 102-239
Classification Level Classification E-value
Superfamily ISP domain 1.38e-38
Family Rieske iron-sulfur protein (ISP) 0.00000181
Further Details:      
 
Domain Number 2 Region: 46-114
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 2.62e-24
Family ISP transmembrane anchor 0.000062
Further Details:      
 
Domain Number 3 Region: 1-45
Classification Level Classification E-value
Superfamily Non-globular alpha+beta subunits of globular proteins 0.0000000000000311
Family Ubiquinol-cytochrome c reductase 8 kDa protein 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1C742
Sequence length 241
Comment (tr|F1C742|F1C742_PERFV) Cytochrome b-c1 complex subunit Rieske, mitochondrial {ECO:0000256|RuleBase:RU004494} OX=8167 OS=Perca flavescens (American yellow perch) (Morone flavescens). GN=Uqcrfs1 OC=Eupercaria; Perciformes; Percoidei; Percidae; Percinae; Perca.
Sequence
VVVKGEKILLTPKKPFLCRESLSGQSPKTGPAVTVSINGCAAVRYAHTDVRVPDFSDYRR
PEVLDPSKSSQDSSEGRRTFSYLVTGATTVVGVYAAKTVVSQFVSSMSASADVLALSKIE
IKLSDIPEGKNMTFKWRGKPLFVRHRTEKEIATEAGVNLAELRDPQHDKDRVQNPSWVIV
LGVCTHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPYYEFPDDSTVVV
G
Download sequence
Identical sequences F1C742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]