SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1D8P7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1D8P7
Domain Number 1 Region: 219-460
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-70
Family Nuclear receptor ligand-binding domain 0.00000000043
Further Details:      
 
Domain Number 2 Region: 85-173
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.44e-26
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1D8P7
Sequence length 461
Comment (tr|F1D8P7|F1D8P7_HUMAN) Nuclear receptor subfamily 1, group H, member 2, isoform CRA_c {ECO:0000313|EMBL:EAW71852.1} OX=9606 OS=Homo sapiens (Human). GN=hCG_22944 OC=Catarrhini; Hominidae; Homo.
Sequence
MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQQESQS
QSQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNK
RSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQ
IALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAM
RRLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPR
MLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences F1D8P7 G3QS62 K7BSQ5
ENSGGOP00000005489 ENSGGOP00000005489 gi|85362735|ref|NP_009052.3| NP_009052.3.87134 NP_009052.3.92137 XP_003813668.1.60992 XP_004061275.1.27298 XP_008964388.1.60992 XP_016792139.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]