SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1DCB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1DCB0
Domain Number 1 Region: 2-186
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-42
Family Duffy binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1DCB0
Sequence length 186
Comment (tr|F1DCB0|F1DCB0_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:ADX61002.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var-2438 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
LSLCNKNFPNMNSNDSSKAKNDLLLDVCLAAKFEGESLTHYKQYEAQYPGSGSTTCTALA
RSFADIGDIVRGKDLFYGNTQEKDQRKKLQQNLKKIFGKIHSGLDREAQARYKGDKKNYF
FQLREDWWTANRETVWKAITCDVKSGNNYFRQTCGDEKTGTLTPSQCRCNGDQVPTYFDY
VPQFLR
Download sequence
Identical sequences F1DCB0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]