SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1DCS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1DCS9
Domain Number 1 Region: 1-140,179-193
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-42
Family Duffy binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1DCS9
Sequence length 193
Comment (tr|F1DCS9|F1DCS9_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:ADX61171.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var-2647 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
LHLCDKNIQQIKTENITTHNLLADVCQAAKYEGTSLKGYHDKYKLTNSSSQLCTMLARSF
ADIGDIVRGRDLYGGNKKKERLEEKLKQYFNNIYENLESAAKKHYNGDKNNDFFQLREDW
WTANRATIWEALTCDVDGSYFHATCSDSDGNSQYQTQKQCRCDKEKAIKGSGGKAGDVNI
VPTYFDYVPQYLR
Download sequence
Identical sequences F1DCS9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]