SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1DDL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1DDL6
Domain Number 1 Region: 1-188
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.36e-43
Family Duffy binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1DDL6
Sequence length 188
Comment (tr|F1DDL6|F1DDL6_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:ADX61458.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var-4090 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
LHLCHHNLEKMGTDKIDSGNAKHKLLAEVCYAAIHEGESLRGQHGQHQETNPGTASQLCT
VLARSFADIGDIVRGKDLFYGNPQEKEQRDKLENNLKEIFKQIHGGLTGGVEERYQDDKE
NFFQLREDWWDANRETVWKAITCKANGTYFRPTCGDKEKGPSMTPSQCRCAGNIRVPTYF
DYVPQFLR
Download sequence
Identical sequences F1DDL6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]