SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1DDW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1DDW9
Domain Number 1 Region: 1-158,186-200
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.59e-40
Family Duffy binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1DDW9
Sequence length 200
Comment (tr|F1DDW9|F1DDW9_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:ADX61561.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var-4187 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
LHLCNKNMVKMDTNNDSKAKHKLLLDVCLAAKYEGESLKGYHDQYDSKYPGSDFSMCTML
ARSFADIGDIVRGRDLYFGKRKKKKQNGKETERDELESKLKEIFKKIHSEVTSGNNKDAL
KTRYNDNEENYYKLREDWWALNRQQVWKALTCEAPKDSKYFRGTCGSGKTATQASHKCRC
DGANVTIVPTYFDYVPQYLR
Download sequence
Identical sequences F1DDW9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]