SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1DEF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1DEF9
Domain Number 1 Region: 2-144,171-185
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-40
Family Duffy binding domain 0.0026
Further Details:      
 
Weak hits

Sequence:  F1DEF9
Domain Number - Region: 136-169
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.034
Family Thyroglobulin type-1 domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1DEF9
Sequence length 185
Comment (tr|F1DEF9|F1DEF9_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:ADX61751.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var-4354 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
LHLRHHNLETINNTTSTAKHDLLAEVCMAAKYEGASIKAHYPPYQHKYVNSGSTICTVLA
RSFADIGDIIRGKDLYRRDNKKVKTDKLQEQLKKYFQKIHDGLTNGVKERYKDDKDLFQL
REDWWTENRETVWKAITCEANGTYFRQTCGTGKPTNDKCRCKDEEGKNETNEVPTYFDYV
PQYLR
Download sequence
Identical sequences F1DEF9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]