SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1KT35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1KT35
Domain Number 1 Region: 415-619,711-750,876-964
Classification Level Classification E-value
Superfamily TPR-like 1.9e-60
Family Tetratricopeptide repeat (TPR) 0.00014
Further Details:      
 
Domain Number 2 Region: 72-371
Classification Level Classification E-value
Superfamily TPR-like 1.56e-56
Family Tetratricopeptide repeat (TPR) 0.0000672
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1KT35
Sequence length 1100
Comment (tr|F1KT35|F1KT35_ASCSU) UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase {ECO:0000313|EMBL:ADY41039.1} OX=6253 OS=Ascaris suum (Pig roundworm) (Ascaris lumbricoides). GN= OC=Ascaridoidea; Ascarididae; Ascaris.
Sequence
MDPSKPQSYFIHPAAYDPAALAGAKLQVMANSPLAVVAAVQKAQQQHVAATLANALVPPA
VNVVDIAALTELAHREYQAGDYANAEQHCNAIWRADQNNVSVLLLLSSIHFQLKNLDKSM
QFSSMAIKANPNCAEAYSNLGNVYKERNQLAEALENYRIAVRLKPDFIDGYINLAAALVA
GGDLEQAVSAYLSALQYNPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWS
NLGCVFNAQGEIWLAIHHFEKAVQLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALNLA
GNHAVVHGNLACVYYEQGLIDLAIDMYRKAIELQPNFPDAYCNLANALKEKGLVEEAEKA
YNTALALCPTHADSQNNLANIKREQGKIEEATRLYLKALEIYPEFAAAHSNLASILQQQG
KLQDAINHYKEAIRIAPTFADAYSNMGNTLKEMGDIGGALQCYTRAIQINPGFADAHSNL
ASIHKDSGNIPEAIQSYSTALKLKPDFPDAFCNLAHCLQIICDWTDYDNRMRKLVAIVEE
QLEKKRLPSVHPHHSMLYPLTHAARMAIAAKHAQLCLEKVQIFHRAPYSFPDRASVRKGH
RLKIGYVSSDFGNHPTSHLMQSIPGMHNRESVEVYCYALSVNDGTNFRQKLMNESEHFVD
LSLIPSNDKAADRIHDDGIHILINMNGYTKGARNEIFAMRPAPIQVMWLGYPGTSGAPFM
DYIITDSVTSPLELAHAYSEKLAYMPHTFFIGDHAQMLKHLTERVILKEKNDTTPLDKDT
VTVVNSVNLEPLLSKADVKPFVRETEVAHGPDRDMIKTEVVLPVIEVPTTEPLKQMIGSG
MIAGNVEGVPVQNGLTTLNQTHVKAATGEEVPHTILVTSRQQYGLPEDAIVFCNFNQLYK
IDPSTLTMWCEILKLVPNSVLWLLRFPFHGEANVIRFCAERGIDARRVVFSNVAAKEEHV
RRGQLADVCLDTPLCNGHTTGMDILWTGTPMITMPLETLASRVASSQLVALGVPELVAKD
REDYIRIAARLGTDREYLSQIRAKVWKARTTSTLFDVRQYCADMEQLLHRMWRRYAEGLP
PDHILSDRDVARESGDLKNL
Download sequence
Identical sequences F1KT35
GS_04744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]