SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1KZ21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1KZ21
Domain Number 1 Region: 381-622
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-27
Family YWTD domain 0.0001
Further Details:      
 
Domain Number 2 Region: 75-112
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 118-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000127
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 4 Region: 226-261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 5 Region: 164-201
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 270-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000018
Family EGF-type module 0.039
Further Details:      
 
Domain Number 7 Region: 294-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000479
Family EGF-type module 0.0061
Further Details:      
 
Weak hits

Sequence:  F1KZ21
Domain Number - Region: 34-74
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0017
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1KZ21
Sequence length 676
Comment (tr|F1KZ21|F1KZ21_ASCSU) Low-density lipoprotein receptor-related protein 1B {ECO:0000313|EMBL:ADY43125.1} OX=6253 OS=Ascaris suum (Pig roundworm) (Ascaris lumbricoides). GN= OC=Ascaridoidea; Ascarididae; Ascaris.
Sequence
MLAFDVMTMSLVVLMLILSSSVNMGLGLGSCHDQNEFDCGYEEDGVRKCIPVEWKCDNMV
DCRLNANDESGCRYIHQCPRGVFACRNGECIDAVFKCNGFDDCGDGTDERGCKEQSRHEA
QCPESQFRCRKGPCITVHAKCDKVKDCPEGDDEEHCTPTAINGSCAEHEFMCDNSCIPST
WKCDGIVDCRDGNDELKELCGLELEEEDELLSLPSREQYLHLSLKSSFCNASQYLCEPGK
CIPREKLCDGRKDCPRGNDEGGRCGECAAYGCSHMCTDRPDGPLCSCREGETLAFDGRIC
VDVNECETAAGHICSHKCINNEGMFKCECFEGYDLGSDTHSCHAKPDPYSAIFFSLGSEV
RHMPPYSVGSTIGYGTYQHNDRVGTVVRSIAFAPSFNHLLMATSNVDHIGHIHSASGGLQ
KCIVDGVKGIANIAIDWVTNNVYYTAQHPSSLTGVGVCGFDGRFCRLLVKGIVSDEYYRR
QVYRGLVVNPVYAIMYWIDVPGSFDSPKIMSAYMDGTNIRTLVSTKLEHPQGLAMDYIKQ
TLYFADVELRLIEKVNVNSHERTMVTSQGVHHPYELAFFDDYVYWTDWSTEAVVAAKVNG
QEMPHVVHSVEQMPYGLAVNHSSFWNRSTSNPCEELSCGHVCVLTVGIKGNVVGRCLCPN
LYKENRQWGMRPSKCK
Download sequence
Identical sequences F1KZ21

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]