SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1L8L6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1L8L6
Domain Number 1 Region: 13-125
Classification Level Classification E-value
Superfamily FKBP-like 2.95e-42
Family FKBP immunophilin/proline isomerase 0.00000769
Further Details:      
 
Domain Number 2 Region: 249-402
Classification Level Classification E-value
Superfamily TPR-like 9.95e-29
Family Tetratricopeptide repeat (TPR) 0.0001
Further Details:      
 
Domain Number 3 Region: 126-241
Classification Level Classification E-value
Superfamily FKBP-like 1.87e-18
Family FKBP immunophilin/proline isomerase 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1L8L6
Sequence length 437
Comment (tr|F1L8L6|F1L8L6_ASCSU) Peptidylprolyl isomerase {ECO:0000256|PROSITE-ProRule:PRU00277} OX=6253 OS=Ascaris suum (Pig roundworm) (Ascaris lumbricoides). GN= OC=Ascaridoidea; Ascarididae; Ascaris.
Sequence
MSGEQIDLTPEKDGGVLKKIEVEGTGELKPSKGDTVYVHYVGTLAENGEKFDSSRDRNEP
FSFTLGKNQVIKGWDLGVASMKKGEKCILTCRADYAYGDSGSPPKIPGGATLNFEVELLR
WQGEDISPDRDGTITRSVIVEGEKYASPSETSTVKVNAVGSYEGRVFFDKEVSFILGEGS
EAGLPEGVDRALRRFNRGEKSAIHLKGSRFTYGANPPAEYNLPPNAEIDFTIFLKDFEKV
KASWELTGDEKLEAAEAAKARGTMFLQQNKYSLALAKYARIVELLEYEKTLEGDKMEKRN
ALLIAGYLNSALVYSKQNETVECIKQCDKALEISSKNVKALYRKAHALQQQNDIEEAIGL
YHKVLELEPTNKAAVQQIAICKQKLAEIREKEKKRFRGMFEKFAARDEKECSATDSGSAP
EKNFQEASTSAQTEMVS
Download sequence
Identical sequences F1L8L6
GS_11901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]