SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1LR55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1LR55
Domain Number 1 Region: 43-198
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000228
Family SMI1/KNR4-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1LR55
Sequence length 295
Comment (tr|F1LR55|F1LR55_RAT) Tubulin polyglutamylase complex subunit 2 {ECO:0000313|Ensembl:ENSRNOP00000070604} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Tpgs2 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MEETPPPMQAGSKPHLEKLTLGVTRILESSPGVTEVSIIEKLPAERHMISSWEQKNNCVM
PEDVRNFYLMTNGFHMTWSVKLDDHIIPLGSMVINGISLTQLIQSSVYSLPNAPTLADLE
DDSQEGNEDHQLEKPHFDCRSAIFELDSCGGNGKVCLVYKNGKPGLAHDTEIWFLDRALY
WHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFSMYKPITYNTSLLTEEPDT
FVNKLDPSKVFKSKNKILIPKKKGPVQPVSGQKGPGPLAPPTSKPSAGCGNPVRK
Download sequence
Identical sequences F1LR55
ENSRNOP00000020148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]