SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1LSJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F1LSJ7
Domain Number - Region: 87-149
Classification Level Classification E-value
Superfamily Globin-like 0.0158
Family Globins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1LSJ7
Sequence length 150
Comment (tr|F1LSJ7|F1LSJ7_RAT) Exocrine gland-secreted peptide 1-like {ECO:0000313|Ensembl:ENSRNOP00000059778} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=LOC108351994 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MAPLSVMLFLITLLFPLMSTEGRVLPQTQKESTISSNHKTNHKAALHKTDSQGEGNIQGR
EKVICASNQEQVLCGDFTNANQRKLNLSQNIMSQRTYCTQNHKVDPGCFKHKANRLQGTR
VRHQGDSFRYNILECFYKCLDLVKKVLISH
Download sequence
Identical sequences F1LSJ7
XP_017452384.1.100692 XP_017459253.1.4139 ENSRNOP00000059778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]