SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1LSY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1LSY2
Domain Number 1 Region: 296-480
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.7e-37
Family Pentraxin (pentaxin) 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1LSY2
Sequence length 494
Comment (tr|F1LSY2|F1LSY2_RAT) Neuronal pentraxin receptor {ECO:0000313|Ensembl:ENSRNOP00000004703} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Nptxr OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
LKFLAVLLAAGMLAFLGAVICIIASVPLAASPARALPGGTDNASAASAAGAPGPQRSLSA
LQGAGGSAGPSVLPGEPAASVFPPPPGPLLSRFLCTPLAAACPSGAEQGDAAGERAELLL
LQSTAEQLRQTALQQEARIRADRDTIRELTGKLGRCESGLPRGLQDAGPRRDTMADGAWD
SPALLVELENAVRALRDRIERIEQELPARGNLSSSAPAPAVPTALHSKMDELEGQLLAKV
LALEKERAALSHGSHQQRQEVEKELDALQGRVAELEHGSSAYSPPDAFKVSIPIRNNYMY
ARVRKAVPELYAFTACMWLRSRSGGSGQGTPFSYSVPGQANEIVLLEAGLEPMELLINDK
VAQLPLSLKDSNWHHICIAWTTRDGLWSAYQDGELRGSGDNLAAWHPIKPHGILILGQEQ
DTLGGRFDATQAFVGDIAQFNLWDHALTPAQVLGIANCTGPLMGNVLPWEDKLVEAFGGA
KKAAFDVCKGRAKA
Download sequence
Identical sequences F1LSY2
ENSRNOP00000052999 10116.ENSRNOP00000004703 ENSRNOP00000004703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]