SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1M342 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1M342
Domain Number 1 Region: 88-335
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.1e-69
Family Nuclear receptor ligand-binding domain 0.00000000205
Further Details:      
 
Domain Number 2 Region: 20-103
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.18e-29
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1M342
Sequence length 418
Comment (tr|F1M342|F1M342_RAT) Hepatocyte nuclear factor 4, gamma (Predicted) {ECO:0000313|EMBL:EDM01044.1} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_41459 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MDSSAPETTSMNTTDSGVNCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRF
SRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTYEGTNIPSINTLAQA
EVRSCQISVPNPSASTDINVKKIASISDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVA
LLRAHAGEHLLLGATKRSMMYKDILLLGNHYVIHRNSCEVEVSRVANRVLDELVRPFQEI
QIDDNEYACLKAIVFFDPDAKGLSDPGKIKNMRFQVQISLEDYINDRQYDSRGRFGELLL
LLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQEMLLGGAANDGGHPHHPMHPHLSQDPLT
GQTILLGPMSTLVHTDQIATPETPLPSPPQGSGQEQYKITANQASVISHQPLSKQKQL
Download sequence
Identical sequences F1M342
NP_001102409.1.100692 NP_001102409.1.4139 ENSRNOP00000011890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]