SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1M7S0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1M7S0
Domain Number 1 Region: 1012-1105
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-26
Family PDZ domain 0.00026
Further Details:      
 
Domain Number 2 Region: 830-938
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-24
Family PDZ domain 0.00011
Further Details:      
 
Domain Number 3 Region: 400-503
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-23
Family PDZ domain 0.0000592
Further Details:      
 
Domain Number 4 Region: 701-813
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-22
Family PDZ domain 0.00043
Further Details:      
 
Domain Number 5 Region: 554-665
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-17
Family PDZ domain 0.00023
Further Details:      
 
Domain Number 6 Region: 125-196
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.18e-16
Family Nucleotide and nucleoside kinases 0.0038
Further Details:      
 
Domain Number 7 Region: 292-329
Classification Level Classification E-value
Superfamily WW domain 0.000000000000519
Family WW domain 0.0013
Further Details:      
 
Domain Number 8 Region: 340-374
Classification Level Classification E-value
Superfamily WW domain 0.00000000127
Family WW domain 0.0029
Further Details:      
 
Domain Number 9 Region: 16-113
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000473
Family PDZ domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1M7S0
Sequence length 1470
Comment (tr|F1M7S0|F1M7S0_RAT) Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 {ECO:0000313|Ensembl:ENSRNOP00000026952} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Magi3 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MSKTLKKKKHWLSKVQECAVSWAGPPGDLGAEIRGGAERGEFPYLGRLRDEPGGGGGTCC
VVSGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKPGKVINKDLRHYLS
LQFQKGSIDHKLQQVIRDNLYLRTIPCTTRAPRDGEVPGVDYNFISVEQFKALEESGALL
ESGTYDGNFYGTPKPPAEPSPFQPDPVDQVLFDNEFDTESQRKRTTSVSKMERMDSSLPE
EEEDEDKEAVNGSGSMETREMHSESSDCWMKTVPSYNQTNRSMDFRNYMMRDENLEPLPK
NWEMAYTDTGTIYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIEDPQYGTYY
VDHLNQKTQFENPVEEAKRKKQIGQAETHSAKTDVERAHFTRDPSQLKGVLVRASLKKST
MGFGFTIIGGDRPDEFLQVKNVLKDGPAAQDGKMAPGDVIVDINGNCVLGHTHADVVQMF
QLVPVNQYVNLTLCRGYALPDDSEDPVVDIVAATPVINGQSLAKGEACMSTQDFKLGAMV
LDQNGKSGKLLSSDHLNGPSDSNEQRASLASSGSSQPELVTIPLVKGPKGFGFAIADSPT
GQKVKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGP
CSPTKTAKMKTDTKETSGSLETINEPTPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYED
KPPNTKDLDVFLRKQESGFGFRVLGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCID
GIPVKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGEKQPEDESPQAFSQSGSPRLNRTE
LPTRSAPQESYDVILQRKENEGFGFVILTSKSKPPPGVIPHKIGRVIDGSPADRCGRLKV
GDHISAVNGQSIVDLSHDNIVQLIKDAGVTVTLTVVAEEEHHGPPSGTNSARQSPALQHR
PMGQAQATHIPGDRTALEGEVGKDVCSSYRHSWSDHKHLAQPDTAVISVVGSRHSQSLGC
YPVELERGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIHVGDQIVEINGEPTQGI
THTRAIELIQAGGNKVLLLLRPGTGLIPDHGDWDIYSPSSSNVIYDEQPPPLPSSHSAAT
FEESHVPVTEDSLIRVQTCEKAEELKDTVQEKKSTLNGSQPEMKYQSVQKNVSKKDPSRS
HGHGDKNLPKGENGVTRRGRSASPKKSVNRHSEEHLEKIPRPLRSDPKGKSRDRSLSPRK
GENKGQVTIKAGSGQDPCRKDRGRSSSPRKQQKIGGNSLSNTEGKLSEAGSRRAAGLSSD
SPEQLPEGKEKSGVSRKDLKLSQLGKNRTRSPEKRSSKVDEASLPSKKTSDTASRVVSEK
EKGRKPGTGERSRDKTGESVQTSAKPLTQEAGEKMALSKASEVTDRGKERAGGAPESSSP
VKKAPITPGPWRVPRANKVTGTAGMADKQL
Download sequence
Identical sequences F1M7S0
10116.ENSRNOP00000026952 ENSRNOP00000027000 ENSRNOP00000026952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]