SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1M8L3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1M8L3
Domain Number 1 Region: 158-264
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.09e-31
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 2 Region: 53-145
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-18
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1M8L3
Sequence length 607
Comment (tr|F1M8L3|F1M8L3_RAT) CUB and zona pellucida-like domain-containing protein 1 {ECO:0000313|Ensembl:ENSRNOP00000045430} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Cuzd1 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MEVTGRLFIWAILAVSCRAQLNSTAAEGRPRCTASLGGANLGETHKALILNLNADENCTW
TIERPENRSIRIIFSHIQLDPDSRCENESIKVFDGRSTSGPLLGEACSKNDFVPVFESSA
NSLTFQIVTDWTRVQRSVFIFYYFFSSGTTIPNCGGYLQTLEGSFSSPNYPRPHPELAYC
VWHIQVEKGYKINLNFTELFLEMDEYCRFDFIAVYDGPSTTSGLLKQVCGRGTPTFESSS
DAMTVVLSTDYANSYRGFFASYASTYVQEVNTTSLSCASDKMRVIISKSYLQSLNYHESN
LQLNDPTCRPSVSNVVEFSIPLHECGTIKKIEDHTISYTNIITFTQSPESAVITRKRHLQ
IVVTCEMEYNSTVEILYITEDDVIQNQSVLGKYNTSMALYESGSFENLIQESPYYVDLNQ
TLFVQATLHTSDPSLVVFLDTCRASPTSDFASPTYDLISSGCSRDETCKVYPLFGHYGRF
QFNAFKFLRHLSSVYLKCKILICDTSDHTSRCNQGCVSRRKRDIPSYKWKTDSVIGPIRL
KRDRLVNGDSGLLPQTHEAEISKQPLSHLHLFSFMVLALNVVIVVTATVRHFLNRWKDHG
YQKLQVY
Download sequence
Identical sequences F1M8L3
ENSRNOP00000045430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]