SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1M8P4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1M8P4
Domain Number 1 Region: 880-1007
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000392
Family GAF domain 0.018
Further Details:      
 
Weak hits

Sequence:  F1M8P4
Domain Number - Region: 159-249,719-762
Classification Level Classification E-value
Superfamily EF-hand 0.000173
Family Polcalcin 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1M8P4
Sequence length 1350
Comment (tr|F1M8P4|F1M8P4_RAT) EF-hand calcium-binding domain 5 {ECO:0000313|Ensembl:ENSRNOP00000038171} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Efcab5 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MLMQVEKKKLLSQADIPSKFDPINYLGEYLMRHNTHYIKDPGMSGYQRVMKEVTEELKIH
VPDTINNRISKMKERVKQKREQREYISTVKVKVATMRKQALEEQFNEWILNPKGMIPIVV
YISSYIMDLKSEVFEEFLKHLCHCAEEFREIITTDMRRQMFAELFLYCDSGKVMALDRQR
TLALLEAFFDKTSSTTRSLLRNPRQWPFVEFEEIELTEFWGDMDIKKHIYENFDELLLKM
NMLAAEKLSGKLTEDKDKNLSQPQEEISTDQELSPELATEPGTATQETAKQKTHRASLKE
QGQGIGLRKPSTSRQRLSRGSVAEQGSRRGSVVNQTQQRGSVAQQGSRRSSGVNQTQQRG
SVAEQGSRRSSGVNETQQRETVAEQGSRRISTAEQEPQTEQDPNRDSVPEQEPPRGSVTE
EGSQRGSISEPGQRRKSFVGDSSTSLEAESRRGSVIDQGQRRASGGQRKGSGGRKMSVSE
NGPYQESIKEEPLGESEHGPQIDTIQEQDADSAPQLEEGGTLEESKTLESNIVKSQEKKP
SLLTHEKQVPMDSEQQREEVPTSSKKERPPGSPQKARLSGTSKKDSQKDKACEPKPQHIE
GKKWLGEFLMSDWKMKYIKSEDEEQAKLICDDSRFTDLHATIRSFQTYKGIKGRSAFDGV
SLDLLQFVQLLETFVGEDTSLSVSQSLVSFFQKNFSETKQEKIKALEQARRNSFQVRRKI
LLEALFEKWDNDGSGFLDLNEIDDLLYTYKEGMERESMKKAKLHINFPKPSPGHEVKLSS
KQFQRYIELVVSELRGNEDQVLENVVEFLMSSLERTHTEGLRNCARRKWLHQIQHAAETS
GVSLEPVYTETFRALTQDAEAHGNKKISAHISLLEENVLLPERGHVLLRNVACTLDDAPF
VLNKVLYRDMKGISFTVVDEGKPIHVPQVQHHGNIFFWNSTRSKNEQNGSFLALPLQDAY
MRIFGVLAVDTLRDPREINIFLPHEIRFYQGVANAFSAAYHYVHSREHILHTVLTGIRWL
FGITAGITTITMCFTEPSSEQEDYVLRNMMLTDHLGVAEIHADPPTISRRACIFRDFLFK
CTDTSEVILASSGGETHIAIPLRQISGEAIGVLDVNIGRSRMLVYQEYKDLQKMMKMIQN
VSYEILGEVSGEIEKQMVLEMEVAGEVKRAAILFFRTMLQDLRGCLRLLDSMEFVSLLLY
EHKHSVDFLQEDLSPQEVEANVTLIHDILKGVILFSQQDKDPFRDLEEWERWKFHINKYL
VEEICALDPTASNVEINVELITRYIQDHSRTQVWKFKNIVIELLYHWISICLTLIELNTQ
QDSFIVPPLPKKSTTTIYAMSSERSFREKL
Download sequence
Identical sequences F1M8P4
ENSRNOP00000038171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]