SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MAU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MAU9
Domain Number 1 Region: 400-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.57e-16
Family Classic zinc finger, C2H2 0.0018
Further Details:      
 
Domain Number 2 Region: 376-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000728
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MAU9
Sequence length 482
Comment (tr|F1MAU9|F1MAU9_BOVIN) Early growth response protein 4 {ECO:0000313|Ensembl:ENSBTAP00000033084} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=EGR4 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MLHLSEFSGPDALLVKSTEGCCSEPSTDLTRLPARDPPAATGYPAGDFLSWALSSCGAGE
YLTDSCLLEGPAPTPPPGLGYSGSFFIQAVPEHPHDPEALFNLMSGILGLTPFPGAEAAA
SRSPLDASFPAGSDALLPGPPDLFSPDPGAAAFPEAFWEASPSAGAPSQCLYEPHLSAPD
VKPGLRAPPASPALDTASAFKGPYSPWELLSAGAPGSCGSQGGYQAAPEARFPTTGAKIE
DLLSISCPAELPGGPASRLYTMGTYDAFPLAPGDLGEGAESLPGLLTPPSGEGGSSGEGG
EFLDGTQPELSPLGLRSATADFPKPLVADIPGSSAVPEPPVPPPAPFPPAKARRKGRRGG
KCSARCFCPRPHAKAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDH
LTTHVRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQKARAEERLKGLGFYSLGLSFA
AL
Download sequence
Identical sequences F1MAU9
ENSBTAP00000033084 9913.ENSBTAP00000033084 ENSBTAP00000033084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]