SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MAV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MAV8
Domain Number 1 Region: 3-89
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000633
Family Calbindin D9K 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1MAV8
Sequence length 872
Comment (tr|F1MAV8|F1MAV8_BOVIN) Trichohyalin-like protein 1 {ECO:0000313|Ensembl:ENSBTAP00000021074} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=TCHHL1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MPQLLRDILCVIETFHKYAREDAATLTCTELKQLIQSEFEDIFQPCAIHAVERNLNLLNI
DSNGAISFDEFVLAIFSFLNVCYLDTQSLLNSEPRQVSKPEGMPHDMGLQVTNETDQWTE
GTSQTQDKVVLPSGTASSTHLSLEERAVEHNRVDPQGHTTAHKLPVETSEHSDSKNQHLK
GDEQSQKVDQDVSATGDSRTQRETSKPMAGSEQISSHTKGEGQNKEILQKGDILARKQSG
TETGGRFGEQEGSLGILHSPLEETTQRPGGSSEDQEVAGEKGVKGHPKSQEPSVQGKDEP
SSEHVDLPKQAAARKPSQTQKSAAAKDESRTAETPEPPIQEKEYETRDLSVQGENRNVSE
TPMVRVERKGVRGPEVHQTVGQKQIEEKTQPPALEEPTEDKKYHELQESSKEKNAGEDSE
THELNSEGGEQKDSESEGAISPGEEARHAEEGTAEALVNSKNAPEAEGTPGTRERIWELT
TLENQSGEKNKMTTKIHDKLVKEDDGYQGEGSEPVATQNDERSPETPNSLTAEDGDSNSE
TSDLFVQGDSQSQTNPFRGSVQGSDSNNPETQKHLALSEEKRVQEAAVLAVRGEDEQVTE
EHAQEHEGQGSATTGRGPAVEPRGHSDTQVFIVRDENTKSLEPGIPGAPNAGITKQLSVR
QLPTKKDSRKELKDQSPSTKKEEDGALEAQEDLVKSLDENNAVSQKTCPATLEEETESPQ
QLAGEQSLSTKEHDPSVSESGLEERMQRDQELCLVERGAEHSSPLYEALQEKMLQQTNVT
QGKHQNQAQTASVASPEIRRNQSSASLTNDSSDGLVFFIDRQALQKYIREFLPDEDPTGA
QQISAPQALEDKQGRPQREELEPQKEASTPKQ
Download sequence
Identical sequences F1MAV8
ENSBTAP00000021074 ENSBTAP00000021074 XP_010801327.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]