SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MB46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MB46
Domain Number 1 Region: 14-189
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.8e-44
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 
Domain Number 2 Region: 166-284
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-30
Family Ypt/Rab-GAP domain of gyp1p 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MB46
Sequence length 436
Comment (tr|F1MB46|F1MB46_BOVIN) TBC1 domain family member 10A {ECO:0000313|Ensembl:ENSBTAP00000049672} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
LEEVPLEVLRQRESKWLDMLNNWDKWMAKKHKKIRLRCQKGIPPSLRGRAWQYLSGGKVK
LQQNPGKFDELDMSPGDPKWLDVIERDLHRQFPFHEMFVSRGGHGQQDLFRVLKAYTLYR
PEEGYCQAQAPIAAVLLMHMPAEQAFWCLVQICEKYLPGYYSEKLEAIQLDGEILFSLLQ
KVSPVAHKHLSQQKIDPLLYMTEWFMCAFSRTLPWSSVLRVWDMFFCEGVKIIFRVGLVL
LKQALGSPEKVRGCQGQYETIERLRSLNPKVMQEAFLVQEVVELPVTERQIEREHLIQLR
RWQETRGELQCPSPPRLHGAKAILEAEPGPRPSLQPSPSIRLPLDAPLSGSKGKSKASKQ
VQKEPREPARESGQRDQPPAASQAKAAAAAGDASPPQDMPVQDPAPQDPQGSAPRDSAHH
RSRESLTSQESEDTYL
Download sequence
Identical sequences F1MB46
ENSBTAP00000049672 ENSBTAP00000049672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]