SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MB86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MB86
Domain Number 1 Region: 154-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.53e-21
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 195-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.45e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 41-98
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 98-154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000177
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 255-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000406
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 3-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000017
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1MB86
Sequence length 310
Comment (tr|F1MB86|F1MB86_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000051952} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
RPRRFSCAACGKAFKRAWELLSHEVVHTVARPFRCGLCAAAFKRHSDCKSHRLVHSDERP
HGCDACGKRFKRASNLQEHRRIHTGERPFPCQSCPKRFKTPYELHRHEPLHAPSRPFPCP
DCGKAFAAGPALLLHRRQHCVDKPHACGVCGKRFTHSHSLRVHERVHTGDRPFVCPLCAK
AFKQSNALASHRRVHSGERPYRCATCGKAFKQSSYLAIHRRTHTGERPYPCDACGKAFSR
PSLLLQHRRVHSPVRPHACRFCPRHFKDLNYRAVHERLHTGDTPYKCGLCGKGFAHPSNL
LQHQSVHPDG
Download sequence
Identical sequences F1MB86
ENSBTAP00000051952 9913.ENSBTAP00000051952 ENSBTAP00000051952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]