SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MBE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MBE4
Domain Number 1 Region: 21-146
Classification Level Classification E-value
Superfamily Lysozyme-like 2.95e-44
Family C-type lysozyme 0.0000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MBE4
Sequence length 148
Comment (tr|F1MBE4|F1MBE4_BOVIN) Lysozyme {ECO:0000256|SAAS:SAAS00814457} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=LYZB OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MTSPLLISLASCLVAVNQASLIGRCDLAKVLHQEDLDGFEGYSLTDWLCLAFVESDFNIT
KVNENTDGSFDYGIFQINSHYWCNDYQSHTENNCQVDCQELLSPNLLAIINCAKKIVSGA
GGMKNWVKWRLHCAGRPLSYWMTGCHLA
Download sequence
Identical sequences F1MBE4 I3RU64
XP_005906018.1.15283 XP_006042369.1.26621 XP_010830700.1.44457 XP_019836292.1.53367 ENSBTAP00000000032 ENSBTAP00000000032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]