SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MBI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MBI0
Domain Number 1 Region: 42-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.15e-36
Family SCAN domain 0.0000449
Further Details:      
 
Domain Number 2 Region: 381-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 426-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-21
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 329-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-20
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 5 Region: 286-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000056
Family Classic zinc finger, C2H2 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1MBI0
Sequence length 485
Comment (tr|F1MBI0|F1MBI0_BOVIN) Zinc finger protein 165 {ECO:0000313|Ensembl:ENSBTAP00000003993} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=ZNF165 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MATESKKATAQNLQEDEGLLIVKMEEEDFVWRQGACLQRNDPLRQELCRRLFRQFCYQDS
PGPRDALSQLRQLCCQWLKPETQTKEQILELLILEQFLAILPGDLQAWVRERYPESGEEA
VTLLEDLERGTDEAVLQIPVCGHGQEPFRRKVASPGPALSVPFQPVDTTALHGSSEPQLL
LDCDNKSENSESMPKLDIYEKMESQKIVSGRISEFVSEGSAEPQDICKSAGKIKRQQEKD
SGESQKSSSAQDAAFSKILTHKNTLRGEIISHDGCERNLNLNSNEFTHQKSCKHSTCDQS
FKWNSDFIKHQRIYAGEKIHPYGKSLKNPNLIKHAAVFTGEKTHQCNECGKAFRHSSKLI
RHQRIHTGERPYECNECGKGFGGSSDLIRHQRIHTGERPFECKECGRAFSLNSHLILHQR
IHTREKPYECSECGKTFRVSSHLIRHLRTHTGEKPYECSECGRAFSQSSHLSQHQRIHKR
ENLFM
Download sequence
Identical sequences F1MBI0
ENSBTAP00000003993 9913.ENSBTAP00000003993 NP_001178305.1.59421 NP_001178305.1.76553 ENSBTAP00000003993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]