SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MBQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MBQ1
Domain Number 1 Region: 97-306,348-497
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.5e-90
Family Protein serine/threonine phosphatase 0.000000897
Further Details:      
 
Domain Number 2 Region: 480-632
Classification Level Classification E-value
Superfamily EF-hand 1.06e-26
Family Calmodulin-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MBQ1
Sequence length 647
Comment (tr|F1MBQ1|F1MBQ1_BOVIN) Serine/threonine-protein phosphatase {ECO:0000256|RuleBase:RU004273} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PPEF1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
SNCFSLSFISCGSAALKAALVIQNWYRGYSARLKTRQRYALTIFQSIEYADEQGQLQLSN
FFSFMLENYTNVPEKEPVLDNYNLNSIQDKDRQDYLGLIEIPDSYCGPRLQFPLTFTDID
LLIEAFKQQQILHAYYVLEVLFETKKVLQQMPNFTHTNTSPSKEITICGDLHGKLDDLFL
IFYKNGLPSVTNPYVFNGDFVDRGKNSMEILMILFVSFLVYPNDLHLNRGNHEDFMMNMR
YGFTKEILHKYKLHGKKILQILEEVYTWLPIGTIIDNEVLVIHGGISESTDLNLLHRIER
NKMRSVLMPPIPMDGDRAEKKNKLGTATVALGIRTSGSFSEQLTKQEWEQVIDILWSDPR
GKRGCYPNTNRGGGCYFGPDITSKILNKYQLKMLVRSHECKPEGYEICHDGKVITVFSAS
NYYEEGSNRGAYIRMSSGTTPRFFQYQITKATCFRPLYQRVNAIESSAIRMLKERMISRK
TDLIRAFQLQDRNKSGKLSMGQWAFSMENVLGLNLPWRSLSSHLVTTDKDGNIDYMSGFQ
DVHIQKPVKEVQSSLIETVYRYRSDLQIIFNIIDSDHSGLISMEEFRSMWRLFKSHYSVH
IDDSQFDELAERMDLNKDGSIDFNEFLKAFYVVHKFDQLNKSDTKLA
Download sequence
Identical sequences F1MBQ1
ENSBTAP00000012557 ENSBTAP00000012557 9913.ENSBTAP00000012557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]