SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MC14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MC14
Domain Number 1 Region: 493-780
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-79
Family Protein kinases, catalytic subunit 0.000000176
Further Details:      
 
Domain Number 2 Region: 62-182
Classification Level Classification E-value
Superfamily L domain-like 2.31e-22
Family Ngr ectodomain-like 0.00000183
Further Details:      
 
Domain Number 3 Region: 291-377
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000294
Family I set domains 0.0000127
Further Details:      
 
Domain Number 4 Region: 194-288
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000015
Family I set domains 0.0000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MC14
Sequence length 797
Comment (tr|F1MC14|F1MC14_BOVIN) Tyrosine-protein kinase receptor {ECO:0000256|RuleBase:RU000312} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=NTRK1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MLRGGRGGQPGGHLRATGPGSLLAWLMLASAGAASCPDVCCPHGPSGLRCTRPGALDNLL
HLPGAENLTELYIENQQHLQQLKRSDLRGLGELRKLTIVKSGLRSVAPNAFHYTPRLGRL
NLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALLWLQRWEEEGRGGVREQKLQCPGQ
GPLALMSNASCGEPTLKIQMSNASVDVGADVLLQCQVEGQGLEQAGWILTELEGSATVME
SGSLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSAQVNVSFPASVHLQAAVEQHHWC
IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLDLAANETMRHGCLRLNQPTHVNNGNYT
LLATNPLGQAAAWVMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKDETPFGVSMA
VGLAVFACLFLSTTFLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEG
KGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEKDKMLV
AVKALKEVSESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFL
RSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQG
LVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIF
TYGKQPWYQLSNTEPQAIECITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHA
RLQALAQAPPVYLDVLG
Download sequence
Identical sequences F1MC14
ENSBTAP00000003980 9913.ENSBTAP00000003980 ENSBTAP00000003980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]