SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MDB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MDB6
Domain Number 1 Region: 14-161
Classification Level Classification E-value
Superfamily EF-hand 1.54e-18
Family Calmodulin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MDB6
Sequence length 171
Comment (tr|F1MDB6|F1MDB6_BOVIN) Tescalcin {ECO:0000313|Ensembl:ENSBTAP00000053746} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=TESC OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
KENFNNVPDLELNPIRSKIVRAFFDNRNLRKGTSGLADEINFEDFLTIMSYFRPIDTTMD
EEQVQLCRKEKLRFLFHMYDSDSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMM
EAASVCVGQMEPDQVYEGITFDDFLKIWQGIDIETKMHVRFLNMETIALCH
Download sequence
Identical sequences F1MDB6
ENSBTAP00000053746 ENSBTAP00000053746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]