SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MDR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MDR1
Domain Number 1 Region: 142-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000281
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MDR1
Sequence length 1600
Comment (tr|F1MDR1|F1MDR1_BOVIN) Zinc finger protein 831 {ECO:0000313|Ensembl:ENSBTAP00000015842} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=ZNF831 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MDVPELACPTSPARDQPAPASGPPGAPGGQASPHLTLGPVILSREQGLAPTVFLKALPIP
LYHTVPPGGLQPRAPLVTGSLDGGSLPFLLGPLLQPEGLGPTRAGKPVAPGLTVNIVGAL
PILSPGLGPALGSPGKVRNAGRYLCPHCGRDCLKPSVLEKHIRSHTGERPFPCATCGIAF
KTQSNLYKHRRTQTHLNNSRLSSESDGGGSSLLEEGEKAAEPTGADRALSQRPLSPGTHA
AGHCPVPTVHVSLVAKNLDRKLDAVPCRGSTFDIKEAPVDSAPGLPLASPQSRWKLPEPR
SPTASRPSSALQQQQVEKPGDSKPSEGRLRKCESTDSGYLSRSDSAEQPPAAGSPLHSLS
EHSAESEGEGGPGPGRAERVAGLELEKRRLEERIARLISHNQAVVDDPQLAHVRPRKTVL
SKQGSIDLPMPYTYKDSFHFDLRPPGPGRLPAALRAARSTCTPPDRARPLFFHSVPTQLS
TGTDCVPVTRSNSLPFVEGTGTWPEPPEPRDSWPQKQKPLSPRPTPARLADAPGGHPRAL
VRQAAVEDLPCPLTADALAPVEDPEGKRPAAEEGSASKGQAAAKKRGQRKLKMFSQEKWQ
VYGKDTFKSIYQRAKASHRGGRKATEVTVGGGAALERPLQQEASGGGDTVVGAKPGPWAS
PPVLAGLLVSEPHKQRETVAGTGGPDQLGSNRAVSPPTLSSGEALCLDSKSPLLPPHEGP
ELECQQFPASGPLKGGDLEAPRPDSKLEGGTCGGEGTKETCQQAHVVPRGPGGSSGEPKA
LEDKLPSERKKLKVEELSCQELLGAGGEIPGGPMQTASPPPQNQDTDPGEKPGGLPGSGN
STESVISGNLRWEGPQDTEPPPRPPGCPSQLASHPPAPHTLTDSVDMVFPPQYLLRFPQR
DTRPLSPLPQKLDQGQDSICKRRGPEVQTSFAESGQGALLPPCPISGQAPAGEDSCWKYP
SWSRSCDQRKGLQREERGGLNAGIPIARALKGSASFLPASMCESWRSGTHDTQEISRSNT
VARAGPSGGVLNSWEPTGELGAPSESATQAPSSGSLACCSHQAGSSLSASMAPHWPELAL
RTNAEPARSCGVQGSFPSLRAEPRLTWCCLSRSLPLPMEQKEKDASVYLGLHLPGGGLQG
EGPDAWLVSKTVSGAWTRIRPGDGGQMQMSKLSDPTARGMLSRDRVSEPEWKKRRSRRRA
KMPRGSSRWKHLSTHSKRYRGNFLQSRVQLRVTRLRKPHWVLRKDGHPPRAKGPDPCRTQ
GQASSEMAGVNPSGEPSCVTSESYVCIENREQEEEESGHVSRSFCPNTSLRTIGDTDRPI
AKEISSAGEHGAGCPLITAVGSGLSLPSDSLGANDSLPAHSKGLDVGSLETHLLPSQQHI
STDPTPCVFSDAQEPSSFVSKGTSLGHDLATSAAAFCPSLGARAGHTTLGIHSVEPQDHS
QGEEETLAQSSPDRKTIEEGVSPNLLPGKPSSGQRISGSVTPGSTGKIHLEIPALGPASA
SSHQEEGKHKSCFPSGGQCGCREGLVPCPLVGPDSVKCQGTGFMALKDDAVPSNPGLPME
VPAASLKTLRKRSLEGMRKQTRVESSDTSSDDEDRLVIEI
Download sequence
Identical sequences F1MDR1
ENSBTAP00000015842 ENSBTAP00000015842 XP_005214998.1.76553 XP_015321607.1.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]