SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MDS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MDS5
Domain Number 1 Region: 1-201
Classification Level Classification E-value
Superfamily L domain-like 1.5e-36
Family Ngr ectodomain-like 0.059
Further Details:      
 
Domain Number 2 Region: 475-585
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.05e-26
Family Calponin-homology domain, CH-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MDS5
Sequence length 625
Comment (tr|F1MDS5|F1MDS5_BOVIN) Leucine rich repeats and calponin homology domain containing 1 {ECO:0000313|Ensembl:ENSBTAP00000003856} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=LRCH1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
LSKNRLVEVPMELCHFVSLEILNLYHNCIRVIPEAIINLQMLTYLNLSRNQLSALPACLC
GLPLKVLIASNNKLGSLPEEIGQLKQLMELDVSCNEITALPQQIGQLKSLRELNVRRNYL
KVLPQELVDLPLVKFDFSCNKVLVIPICFREMKQLQVLLLENNPLQSPPAQICTKGKVHI
FKYLSIQACQIKTTDSLYLHTMERPHLHQQVEDGKKDSDSGVGSDNGDKRLSATEPSDED
AVSLNVPMSNIMEEEQMKEDSCHRLSPVQGGFHQEFQPAPSLVSDSDNSGEDRGQFSHGK
DVIHSEFINYMKEKTEACEELLRIEEDAHWPSEGTISASKDQDLDIAMIEQLREAVDLLQ
DPSRLSTDITERSVVNFYPVDPADDLELQDSTLNGQIQLERSPECEAQNDLTLQSNGSEY
SPNEMRENSPASSPTNTSTALFGLKPRSVFLRPQRNLESIDPQFTIRRKMEQMREEKELV
EQLRESIEMRLKVSLHEDLGAALMDGVVLCHLVNHIRPRSVASIHVPSPAVPKLSMAKCR
RNVENFLEACRKLGVPEADLCSPYDILQLDFRHIRKTVDTLLALGEKPPQPTSALRSRDL
ISFCLVHILFIVLIYITYRWNALPP
Download sequence
Identical sequences F1MDS5
ENSBTAP00000003856 ENSBTAP00000003856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]