SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1MDX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MDX6
Domain Number 1 Region: 77-392
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.91e-97
Family Glycosyl hydrolases family 35 catalytic domain 0.0000785
Further Details:      
 
Domain Number 2 Region: 509-651
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.53e-26
Family Beta-galactosidase LacA, domains 4 and 5 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MDX6
Sequence length 659
Comment (tr|F1MDX6|F1MDX6_BOVIN) Beta-galactosidase {ECO:0000256|RuleBase:RU000675} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=GLB1L3 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
RFPCPFSPRLSWRRVLCVLFLPFVSSGFAPPAKYRNNFIFERRKLPPNPRRFDWSHLTPR
ELKNRSQGIQTEERAGRNPYFTLEGHEFLILGGSVHYFRVPRASWRDRLLKLRACGFNTV
TTYVPWNLHEPERGTFDFSGNLDLEAFILLAEEVGLWVILRPGPYICSEMDLGGLPSWLL
QDPTSQLRTTNRSFVNAVNKYFDHLIPRVALLQYLQGGPIIAVQVENEYGFFYKDEAYMP
YLLQALQQRGIGGLLLTADSTEEVMRGHIKGVLASINMKGFKVDSFKHLYKLQRHKPILI
MEFWVGWFDTWGIDHRVMGVNEVEKSVSEFIRYGISFNVYMFHGGTNFGFMNGATSFEKH
RGVTTSYDYDAVLTEAGDYTAKYFMLRSLFESILVRPLPPVPSPTPKAVYPSLKLSHYLP
LWEALPYLQRPVTSNVPINMENLPINNGNGQSFGFVLYEMTICSGGRLHANAQDEAQVFL
NETSLGILTDVYRDIDIPPITECQLLRILVENQGRVNFSWKIQNQRKGLIGPVTLDKIPL
NWFTIYSLELKTQFFKKLRSARWRPLGGPSSSPAFHLGTLMADSSPQDTFLQLLGWNRGC
VFINGRNLGRYWNIGPQEALYLPGSWLQPGTNEIVLFEKEKSGSGVYSTDVRRFRFSVG
Download sequence
Identical sequences F1MDX6
ENSBTAP00000024472 ENSBTAP00000024472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]