SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1ME15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1ME15
Domain Number 1 Region: 21-162
Classification Level Classification E-value
Superfamily EF-hand 9.1e-36
Family Calmodulin-like 0.00000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1ME15
Sequence length 166
Comment (tr|F1ME15|F1ME15_BOVIN) Myosin regulatory light chain 2, ventricular/cardiac muscle isoform {ECO:0000313|Ensembl:ENSBTAP00000024444} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=MYL2 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MSPKKAKKRAEGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN
VKNEEIDEMLKEAPGPINFTVFLQMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYIK
EMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Download sequence
Identical sequences F1ME15
9913.ENSBTAP00000024444 ENSBTAP00000024444 ENSBTAP00000024444 XP_005217810.1.76553 XP_005897466.1.15283 XP_010839683.1.44457 XP_010839684.1.44457 XP_014334206.1.15283 XP_019833437.1.53367 XP_019833438.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]