SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MEC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MEC3
Domain Number 1 Region: 19-146
Classification Level Classification E-value
Superfamily Lysozyme-like 1.31e-51
Family C-type lysozyme 0.00000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MEC3
Sequence length 147
Comment (tr|F1MEC3|F1MEC3_BOVIN) Lysozyme {ECO:0000256|SAAS:SAAS00814457} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MKALLILGLLLLSVAVQGKTFKRCELARTLKNLGLAGYKGVSLADWMCLAKGESSYNTQA
KNFNRGSQSTDYGIFQINSKWWCNDGKTPNAVNGCGVSCSALLKDDITQAVACAKKIVSQ
QGLTAWVAWKNNCRNRDLTSYVQGCGV
Download sequence
Identical sequences F1MEC3
ENSBTAP00000050453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]