SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MG51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MG51
Domain Number 1 Region: 295-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.49e-22
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 2 Region: 182-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-20
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 3 Region: 2-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.1e-19
Family KRAB domain (Kruppel-associated box) 0.00047
Further Details:      
 
Domain Number 4 Region: 134-183
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000105
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 5 Region: 246-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000178
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 341-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000236
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1MG51
Sequence length 381
Comment (tr|F1MG51|F1MG51_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000048327} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
DSVVFEDVTVNFTLEEWALLDFSQKKLYRDVMGETFRNLASVGTTWEDHDTEDQYRNQGR
KLSRSQKAERICEGKEDSPCGENVNLIPNHNPNKKTLFRVRPRGRKVCGKDLMHHSSHNR
STRSHIGHKPYEYQIHERTHTGEKSYECQHCGKAYRYYQAFRTQKRTHTGEKSYECRKCS
KAFSCPSSFRKHQRIHTGEKPYECKECGKAFRAVASLHTHLITHTGVGPYKCKQCDIVTL
IYEQTARIHERTHTGEKLYECNQCGKTCRGCQSFQRHESNHTGEKPYEYKKCHKVFRGYS
SLQNHERTHTGEKRYACTECGKTYRWHQSFRRHERTHTGEKPYECKECGKTFNHPASFRR
HERTHGVKPFDCKECGKDFSW
Download sequence
Identical sequences F1MG51
ENSBTAP00000048327 ENSBTAP00000048327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]