SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MHD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MHD4
Domain Number 1 Region: 67-374
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.76e-83
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0016
Further Details:      
 
Domain Number 2 Region: 362-471
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.34e-16
Family Anticodon-binding domain of Class II aaRS 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MHD4
Sequence length 475
Comment (tr|F1MHD4|F1MHD4_BOVIN) Prolyl-tRNA synthetase 2, mitochondrial {ECO:0000313|Ensembl:ENSBTAP00000050033} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PARS2 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MEGLLTRCRALPALATCSHQLSQYAPQRFHHCAPGRGKRLMLSRMFQPQKLREDQVLSLE
GRSGDLTCKSQRLMLQMGLIHPASPGCYHLLPYTVRAMEKLVRVIDQEMQTIGGQKVNMP
SLSPAELWRATKRWDSMGRELLRLRDRHGKDYCLGPTHEEAITALVASQKTLSYKQLPFL
LYQVTRKFRDEPRPRFGLLRGREFYMKDMYTFDSSPEAAQLTYSLVCDAYSSLFNRLGLR
CIKVQADVGSIGGMVSHEFQLPVDVGEDRLVVCPSCHFSANMETLDSSRTNCPACQGPLT
ETKGIEVGHTFYLGTKYSSIFNAQFINVHGKPSLAEMGCYGLGVTRILAAAIEVLSTEDC
VRWPGLLAPYQVCLIPPKKGSKEEAAAELAGDLYNHITEAVPQLQGEVLLDDRTHLTIGN
RLKDANKLGYPFVIIAAKRALDDPAHFEVWCQNTGEVVFLTREGVLELLSQVQVV
Download sequence
Identical sequences F1MHD4
XP_002686423.1.76553 XP_585755.2.59421 ENSBTAP00000050033 ENSBTAP00000050033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]