SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MHS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MHS5
Domain Number 1 Region: 5-99
Classification Level Classification E-value
Superfamily EF-hand 6.41e-23
Family S100 proteins 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MHS5
Sequence length 156
Comment (tr|F1MHS5|F1MHS5_BOVIN) Protein S100-A9 {ECO:0000313|Ensembl:ENSBTAP00000008523} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=S100A9 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MEDKMSQMESSIETIINIFHQYSVRLGHYDTLIQKEFKQLVQKELPNFLKKQKKNEAAIN
EIMEDLDTNVDKQLSFEEFIMLVARLTVASHEEMHNTAPPGPGHRHGPGYGKGGSGSCSG
QGSPDQGSHDQGSHGHGHGHSHGGHGHSHGGHGHSH
Download sequence
Identical sequences F1MHS5
XP_005203785.1.76553 XP_005203786.1.76553 XP_005203787.1.76553 ENSBTAP00000008523 ENSBTAP00000044096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]