SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MI10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MI10
Domain Number 1 Region: 5-76
Classification Level Classification E-value
Superfamily EF-hand 0.0000000787
Family Calmodulin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MI10
Sequence length 260
Comment (tr|F1MI10|F1MI10_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000051638} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
LALWTFRLLDENSDCLINFKEFSSAIDIMYNGSFTEKLKLLFKLHISPAYTEVQYKDPSK
GDELSKEELLYFSQLHVSKPAKEKEAKSARNSPEKEKEKVNIQAYLSQWQDELLKKEENI
KDLPRMNQSQFIQFSKTLYNLFHGDPEEESLYQAIAVVTSLLLRMEEVGRKLHSPTSAMK
GLSGAAVCVSGVPSEGQAEKPLEKEPSSPREEPQWSFAFEQILASLLNEPALVKFFEKSI
DLKAKLENAKTSQLSCRTKK
Download sequence
Identical sequences F1MI10
ENSBTAP00000051638 ENSBTAP00000051638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]