SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MI30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MI30
Domain Number 1 Region: 100-386
Classification Level Classification E-value
Superfamily L domain-like 9.52e-50
Family Ngr ectodomain-like 0.0061
Further Details:      
 
Domain Number 2 Region: 402-711
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.01e-42
Family Rhodopsin-like 0.00049
Further Details:      
 
Domain Number 3 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MI30
Sequence length 759
Comment (tr|F1MI30|F1MI30_BOVIN) Relaxin/insulin like family peptide receptor 1 {ECO:0000313|Ensembl:ENSBTAP00000013620} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=RXFP1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MTSRPVFLYILIFGKYFAPGRAQNAPCDLGYFPCGNTTKCLPQQLQCNGVDDCENHVDED
NCGDINGWSTQFDRYYGNNYKMTSLYPSIVAETSECLVGSPPMQCICQGLELECDEINLR
AVPSVSSNVTFMSLRRNLIRKLPPNVFKRYHGLQTLCLQNNKIRSVSVYAFRGLYSLTKL
YLSHNRITLLKPGVFEDLHRLEWLIIEDNHLNRISPLTFYGLNSLILLVLMNNVLTRLPD
KSLCQHMPRLHWLDFEGNHIHNLRNLTFISCSNLTVLVMRKNKINHLSENTFAPLQKLDE
LDLGSNKIENLSPHIFKDLKELSQLNLSYNPIQTIQANQFDNLIKLKSLSLEGIEISNIQ
QRMFRPLMNLSYIYFKRFQYCGYAPHVRICKPNTDGLSSLEDLLASIIQRVFVWVVSAVT
CFGNIFVICMRPYIRSENKLHAMSIISLCCADCLMGIYLFVIGAFDLKFRGEYNKHAQLW
MESIHCQLLGSLAILSTEVSVLLLTFLTLEKYICIVYPFRCLRPGKCRTITVLILIWIIG
VIVAFIPLSNKEFFKNYYGTNGVCFPLHSEDAESTGAQIYSVAIFLGINLAAFIIIVFSY
GSMFYSIHQSAITANEIRNQVKKEMILAKRFFFIVFTDALCWIPIFILKFLSLLQVEIPG
TITSWVVIFILPINSALNPILYTLTTRPFKEMIHQFWYNYRQRRSIDSKGSQKTYAPSFI
WVEMWPMQEMPSELMEPVLFADSSELSLISQSTKLNSYS
Download sequence
Identical sequences F1MI30
XP_002694461.1.76553 XP_610789.4.59421 ENSBTAP00000013620 ENSBTAP00000013620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]