SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1MI92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MI92
Domain Number 1 Region: 305-466
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.18e-43
Family Dual specificity phosphatase-like 0.00093
Further Details:      
 
Domain Number 2 Region: 270-317
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.00000327
Family DEK C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MI92
Sequence length 649
Comment (tr|F1MI92|F1MI92_BOVIN) Slingshot protein phosphatase 3 {ECO:0000313|Ensembl:ENSBTAP00000018426} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=SSH3 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MALVTVSRSPPASGHSTPVGPTQDPVSQRRSRLQRRQSFAVLRGAVLGLQDGGDDGDASR
PSPEPAEEPPGEGQPHGDQTDNGHGPPSPGRQEQSQHLCLMVELLRPQDDIRLAAQLEAA
RAPRLRYLLVVSTREGLSRDETVLLGVDFPDSSSPSCTLGLVLPLWSDTQVYLDGDGGFS
VTSGGQSRIFKPVSIQTMWATLQVLHQACEAALSSGLVPGGSALAWASHYQDRLSSDQSC
LNEWMAMADLESLRPPCVESSRPSEQEQMEQAIRAELWEVLDTSDLDNVTSKEIRQALEL
RLGCPLQQYRDFIDNQMLLLMAQQDRASRIFPHLYLGSEWNAANLEELQRNRVSHILNMA
REIDNFYPERFTYHNVRLWDEESAQLLPHWKETHRFVEAARAQGTRVLVHCKMGVSRSAA
TVIAYAMKQYGWSLEQALRHVQELRPIARPNPGFLRQLQTYQGILTASRQSHVWEQKAGG
ASPEEPLAPEVSTPFPPLQPEPGGSGELSVMGSEDSQAAPKEAPGSRPRINLRGVMRSIS
LLEPPSELDSPSGDADLPEVFSSKESSDEDPPQPFPQPSSAKGGRQVHRGPWPALKSRQS
VAALNSAALVASRTRAFQEQGEAGCASTPRHQKIVRQASVDSSGEEGEV
Download sequence
Identical sequences F1MI92
ENSBTAP00000018426 ENSBTAP00000018426 9913.ENSBTAP00000018426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]