SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MJL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MJL8
Domain Number 1 Region: 20-283
Classification Level Classification E-value
Superfamily L domain-like 7.29e-49
Family Ngr ectodomain-like 0.012
Further Details:      
 
Domain Number 2 Region: 279-372
Classification Level Classification E-value
Superfamily Immunoglobulin 9.18e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 405-480
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000984
Family Fibronectin type III 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MJL8
Sequence length 636
Comment (tr|F1MJL8|F1MJL8_BOVIN) Leucine rich repeat and fibronectin type III domain containing 4 {ECO:0000313|Ensembl:ENSBTAP00000049410} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=LRFN4 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MAPPLLLLLLASGAAACPLPCICQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFI
QALGPPDFRNMTGLVDLTLSRNAITRIGARAFGDLESLRSLHLDGNRLAELGAGSLRGPA
NLQHLILSGNQLGRIAPGAFDDFLGSLEDLDLSYNNLRQVPWAGIGAMPALHTLNLDHNL
IDALPPGAFAQLSQLSRLDLTSNRLATLAPDPLFSRGRHAEASPAPLVLSFSGNPLHCNC
ELLWLRRLARPDDLETCASPPGLAGRYFWTVPEGEFSCEPPLIARHTQRLWVLEGQRATL
RCRALGDPVPTMHWVGPDDRLVGNSSRARAFPNGTLEIGVTGSGDAGAYTCIATNPAGEA
TARVELRVLALPHGGNGSTEGGRPGPSDIAASARTAAEGEGTPESEPAVQVTEVTATSGL
VSWGPGRPADPVWMFQLQYNSSEDETLIYRIVPASSHHFLLKHLVPGADYDLCLLALSPA
AGPSDLTATRLLGCAHFSTLPATPLCHALQAHVLGGTLTVAVGGVLVAALLVFTVALLVR
GRGAGNGRLPLKLSHVQSQTNGGPSPTPKAHPPRSPPPRPQRSCSLDLGDSGGCYGYARR
LGGAWARRSHSVHGGLLGAGGRGAGGSAERLEESVV
Download sequence
Identical sequences F1MJL8
NP_001193183.1.59421 NP_001193183.1.76553 XP_005227167.1.76553 ENSBTAP00000049410 ENSBTAP00000049410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]