SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MJZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MJZ4
Domain Number 1 Region: 57-336
Classification Level Classification E-value
Superfamily L domain-like 9.52e-56
Family Ngr ectodomain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 266-554
Classification Level Classification E-value
Superfamily L domain-like 2.55e-54
Family Ngr ectodomain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MJZ4
Sequence length 610
Comment (tr|F1MJZ4|F1MJZ4_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000044542} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=IGFALS OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
APPQAPLPAGVPALVVLLVSWAALGPHGLEGVEPVAPADPEGLQCPAVCSCGHDDFTDEL
SVFCSSRNLTQLPGGLPPGTRALWLDGNNFSSIPAAAFRNLSGLGFLNLQGSGLASLEPQ
ALLGLRGLCHLHLEHNRLHALAAHTFLHTPGLASLGLSNNLLSRLDEGLFRGLAHLWDLN
LGWNSLTVLPDTAFQGLAGLRELVLAGNKLAYLQPPLFCGLGELRELDLSRNTLRSVKAN
VFVKLPKLQKLYLDHNLVAAVAPGAFLGMKALRWLDLSHNRVGSLLEDSFPGLLGLHVLR
LSHNVLAGLRPRTFKDLHFLEELQLGHNRLRQLPEEAFAGLGQLEVLALNDNQLQELRPG
GFLGLRNLAVLNLSSNCLRDLPERAFQGLAKLHSLHLEGGCLARLGPLAFAGLSGLRRLF
LKGNSIADVDERSLGGLAELLELDLTANQLTHLPGRLFQDLGRLEYLLLARNRLSALPAD
ALGPLQRTFWLDVSHNRLEALPAAALAPLSRLRFLSLRNNSLRTFAPQPPGLERLWLEGN
PWDCGCALGALRAFALQQPASVPRFVQALAEGNDDRQPPVLAYNNITCASPPSLAGLDLR
DVGEAHFAHC
Download sequence
Identical sequences F1MJZ4
ENSBTAP00000044542 ENSBTAP00000044542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]