SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MK15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MK15
Domain Number 1 Region: 243-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-26
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 2 Region: 300-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 355-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.75e-21
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 397-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.74e-20
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 1-41
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000017
Family KRAB domain (Kruppel-associated box) 0.0035
Further Details:      
 
Domain Number 6 Region: 109-153
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000251
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MK15
Sequence length 458
Comment (tr|F1MK15|F1MK15_BOVIN) Zinc finger protein 134 {ECO:0000313|Ensembl:ENSBTAP00000006170} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=ZNF134 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
FSWEEWSLLNEAQRRQYRDVMLQVFALISSLAFFSMIGHHIWAKLAMGGLPWPVLSFSLA
LSFLCDYDNFLLSGCWHGVDKEEAASEQSVTVAVSHVHASRADSLTQMAHPCNLCGPILK
DVLHLDEHRETRHGLKPYTCGACGRQFWFSANFDQPQKLYDVEKLLRGDKGKTSFVTNYR
ACEEPLLSEKPFAYKEEQKKFQASLGSHQQKATPSNRKTRSPESGLALHIGQMHYKCIEC
GKAFSRKDTLVQHQRIHTGEKPYECSECGKAFSRKATLVQHQRIHTGEKPYECGECGKYF
SHHSNLIVHQRVHNGARPYKCNDCGKVFRHKSTLVQHESIHTGENPYVCSDCGKSFGHKY
TLIKHQRIHTEARPFECIECGKFFSRSSDFIAHQRVHTGERPFVCSKCGKDFIRTSHLVR
HQKVHTGERPYECNECGKSYSLSSHLIRHQKVHAAGRL
Download sequence
Identical sequences F1MK15
ENSBTAP00000006170 ENSBTAP00000006170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]