SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MLH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MLH2
Domain Number 1 Region: 229-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 565-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.67e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 173-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.87e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 509-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.14e-21
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 607-659
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 397-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-19
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 7 Region: 340-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-18
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 8 Region: 454-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.72e-18
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 9 Region: 89-134
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 10 Region: 135-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 11 Region: 1-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-16
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 12 Region: 285-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000209
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1MLH2
Sequence length 668
Comment (tr|F1MLH2|F1MLH2_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000049737} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
QGGVTFPDIAVRFSQREWRLLDETQRLLYLDVMLENYTLISSLVKIWRPTNLHEFSECRY
QVAAVEQKLVEQQGTQYSQKLLRAPDSMCQRSHTGERPYDCSECGKSFTTNRILRSHQRS
HTGERPYKCSECGEKPYKCYECGKSFTSTNSFRYHRRSHTGEKPYKCYECGKSFTSTGAL
QYHQRSHTGERPYKCSECGKSFMSRSSFICHNRSHTGERPYKCSECEKSFTSRPSLRYHQ
RSHAGARPYKCNECGKSFLTNSHLHRHQRVHTEERPYACGECGKSFASSTSLRLHEGTHT
ERPIECSECGKSFFNPVVFHYHQRIHSSEWPYRCGECGKSFTSKFNFRYHQGIHSGDRSY
VRCNECKKSFTTISSLRNHQRVHSGERPYECSECGKSFMYRSALKCHQKSHARERPFECS
ECGKSFLFRSTLIEHQRVHTGKSAYVCTECGKSYNSKCRFIEHQSIHKGERRYECRECGK
SFNFNSALYYHKKTHAGEKPYKCIECGKSFITNYLLRVHQRAHTGEKPFECSECGKSYTL
NYYLRCHLKVHTGERPYKCTKCGKSFTTSYQLRIHLRSHTGEKPYECSECGRSFSSKSGL
CYHQSAHTGERPYECGDCGKTFVQRNHLIIHQRAHTGERPYKCSECGKSFTRGNSLYYHQ
KVHRGERP
Download sequence
Identical sequences F1MLH2
9913.ENSBTAP00000049737 ENSBTAP00000049737 ENSBTAP00000049737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]