SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MLL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MLL8
Domain Number 1 Region: 6-153
Classification Level Classification E-value
Superfamily Nudix 2.84e-28
Family MutT-like 0.000000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1MLL8
Sequence length 158
Comment (tr|F1MLL8|F1MLL8_BOVIN) Nudix hydrolase 1 {ECO:0000313|Ensembl:ENSBTAP00000003218} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=NUDT1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
GTMCASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVHEGETIEDGAKRELQEESG
LTVDALHKVGQITFEFVGDPELMDVHVFCTDRVQGTPVESDEMRPQWFRLDQIPFGDMWP
DDSYWFPLLLQRKKFRGYFRFQGQDTILDYTLHEVDAV
Download sequence
Identical sequences F1MLL8
ENSBTAP00000003218 ENSBTAP00000003218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]