SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MLS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MLS3
Domain Number 1 Region: 399-703
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.58e-114
Family Mammalian PLC 0.000000387
Further Details:      
 
Domain Number 2 Region: 239-397
Classification Level Classification E-value
Superfamily EF-hand 9.66e-38
Family EF-hand modules in multidomain proteins 0.013
Further Details:      
 
Domain Number 3 Region: 723-848
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.59e-32
Family PLC-like (P variant) 0.00036
Further Details:      
 
Domain Number 4 Region: 110-223
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-26
Family Pleckstrin-homology domain (PH domain) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MLS3
Sequence length 1096
Comment (tr|F1MLS3|F1MLS3_BOVIN) Phosphoinositide phospholipase C {ECO:0000256|RuleBase:RU361133} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PLCL1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MAEGAASREGSAPPDAAGSEDDPRVGPDATSGDCVAAAPGGRWRDRRSGVALPGAAGPPA
DSEAALLEAARATPRRSSIIKDPANQKCGGRKKTVSFSSMPSEKKISSASDCITFMQAGC
ELKKVRPNSRIYNRFFTLDTDLQALRWEPSKKDLEKAKLDISAIKEIRLGKNTETFRNNG
LADQICEDCAFSILHGENYESLDLVANSADVANIWVSGLRYLVSRSKQPLDFMEGNQNTP
RFMWLKTVFEAADIDGNGIMLEDTSVELIKQLNPTLKESKIRLKFKEIQKSKEKLTTRVT
EEEFCEAFCELCTRPEVYFLLVQISKNKEYLDANDLMLFLEAEQGVTHITEDMCLDIIRR
YELSEEGRQKGFLAIDGFTQYLLSSECNIFDPEQSKVAQDMTQPLSHYYINASHNTYLIE
DQFRGPADINGYVRALKMGCRSIELDVNDGSDNEPILCNRNNMTTHLSFRSVIEVINKFA
FVASEYPLILCLGNHCSLPQQKVMVQQMKKVFGSKLYTEAPLLSESYLPSPEKLKRMIIV
KGKKLPSDTDVLEGEVTDEDEEAEMSRRMSVDYNGEQKQILLCRELSDLVSICKSVQYRD
FELSMKSQNYWEICSFSETEASRIANEYPEDFVNYNKKFLSRIYPSAMRIDSSNLNPQDF
WNCGCQIVAMNFQTPGPMMDLHTGWFLQNGGCGYVLRPSIMRDEVSYFSANTKGIVPGVS
PLVLHIKIISGQNFPKPKGACAKGDVIDPYVCIEIHGIPADCSEQRTKTVQQNSDNPIFD
ETFEFQVNLPELAMIRFVVLDDDYIGDEFIGQYTIPFECLQPGYRHVPLRSFVGDIMEHV
TLFVHIAITNRSGGGKPQKRSLSVRMGKKVRECTMLRNIGLKNIDDIFKVAVHPLREAID
MRENMQNAIVSVKELCGLPPIASLKQCLLTLSSRLITSDNTPSVSLVMKDNFPYLEPLGA
IPDMQKKMLAAYDLMIQESRFLIEMADTVQEKIVQCQKAGMEFHEELHNLGAKEGLKGRK
LNKATESFAWNITVLKGQGDLLKNAKNEAIENMKQIQLACLSCGLSKAPSSGAEVKSKRS
LEAIEEKESCEDNGKL
Download sequence
Identical sequences F1MLS3
ENSBTAP00000053252 NP_001178208.1.59421 NP_001178208.1.76553 ENSBTAP00000053252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]