SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MMF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MMF2
Domain Number 1 Region: 184-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.99e-22
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.98e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-21
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 4 Region: 526-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-19
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 226-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-17
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 6 Region: 568-620
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 120-177
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000782
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 8 Region: 91-133
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000162
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 9 Region: 1-33
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000196
Family KRAB domain (Kruppel-associated box) 0.0029
Further Details:      
 
Domain Number 10 Region: 381-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000214
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MMF2
Sequence length 623
Comment (tr|F1MMF2|F1MMF2_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000008008} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
WSLLDKSQKNLFRNVMLETVSHLVSVGESVNSWNKEQSCGLKQQEASKVSPGERQRPGLQ
GKTVSAGVLSPWRHQMKKAHILYYVSSKFQGMIHTGEKPYKCSLCGNGYFLRKHNRVHTG
ETRFECHVCGKLFKVHTWNMRKHTGEKLYKCRLCEKSFHQISYLRKHEKLHPKEKRYECC
QCGTFSQSSGLSQHKRIHTGEKPHVCLVCGKAFSQSSGLTRHKRTHTGEKLYQCQRCGST
FSQYANLRRHERTHTGEQPYECQLCGKCFSHCSSLRQHEETQHQRESRTPSKYNMGVFSN
NSKLLKTLEDISYQKKKILCRRCCYYKALFKFCSESLFRQQEVSHPQGDPAECADLGDEV
TPTSSLQYSIVPFRSKHNVSKQHGKSLSQGSFLNGQGHIHTRRKSCECALCGKVFNRCSS
LSRHKMIHTGEKPFKCQLCEKVFNQRFSLKVHEKTHTGEKPYECHQCGKAFSRCASLRRH
SMIHTGEKPFKCHLCGKVFNQKSSLKQHERTHTGEKRYECHQCGKAFLQSSGLSSHKKVH
TGEKPHVCLECGKAFTHSSGLHVHKRIHIKEKPHVCSVCRKAFNKYAKLREHERTHSGEK
PYECQLCGEHFTRASSLRRHKGT
Download sequence
Identical sequences F1MMF2
ENSBTAP00000008008 ENSBTAP00000008008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]